DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIalpha and TTBK2

DIOPT Version :9

Sequence 1:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_005254228.1 Gene:TTBK2 / 146057 HGNCID:19141 Length:1250 Species:Homo sapiens


Alignment Length:235 Identity:86/235 - (36%)
Similarity:119/235 - (50%) Gaps:27/235 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 GKEKNFNTLVMDLLGPSLEDLFNFCTR-HFTIKTVLMLVDQMIGRLEYIHLKCFIHRDIKPDNFL 146
            |:...||.:||.|.|.:|.||....:| .|||.|.|.|..|::..:|.||...|:||||||.||.
Human    90 GRNDRFNYVVMQLQGRNLADLRRSQSRGTFTISTTLRLGRQILESIESIHSVGFLHRDIKPSNFA 154

  Fly   147 MG-IGRHCNKLFLIDFGLAKKF-------RDPHTRHHIVYREDKNLTGTARYASINAHLGIEQSR 203
            || ....|.|.:::|||||::|       |.|        |......||.||||||||...|..|
Human   155 MGRFPSTCRKCYMLDFGLARQFTNSCGDVRPP--------RAVAGFRGTVRYASINAHRNREMGR 211

  Fly   204 RDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPAEFSMYLNYCRS 268
            .||:.||.|:::.|..|.|||:.:|..      |::...|......::.|..|.|||::|::..|
Human   212 HDDLWSLFYMLVEFVVGQLPWRKIKDK------EQVGSIKERYDHRLMLKHLPPEFSIFLDHISS 270

  Fly   269 LRFEEQPDYMYLRQLFRILFRTLNHQYDYIYDWTMLKQKT 308
            |.:..:|||..|..:|....:|........:||    :||
Human   271 LDYFTKPDYQLLTSVFDNSIKTFGVIESDPFDW----EKT 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 80/209 (38%)
Pkinase_Tyr 23..284 CDD:285015 80/209 (38%)
TTBK2XP_005254228.1 PKc_like 75..287 CDD:304357 80/210 (38%)
SPS1 78..>267 CDD:223589 74/190 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.