Sequence 1: | NP_061826.1 | Gene: | HOXC5 / 3222 | HGNCID: | 5127 | Length: | 222 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_996167.1 | Gene: | Antp / 40835 | FlyBaseID: | FBgn0260642 | Length: | 378 | Species: | Drosophila melanogaster |
Alignment Length: | 361 | Identity: | 100/361 - (27%) |
---|---|---|---|
Similarity: | 126/361 - (34%) | Gaps: | 152/361 - (42%) |
- Green bases have known domain annotations that are detailed below.
Human 1 MSSYVANSF-------------------------YKQS---------PNIPAYNMQTCGNYGSAS 31
Human 32 EVQASRYCYGGLDLSITFPPPAPSNSLHGV----------------------------------- 61
Human 62 ------------DMAANPRAHPDRP----ACSAAAAPG--------------------------- 83
Human 84 --HAPGRDEA--------AP---------LNPGMYSQKAARPALEE-----RAKSSGEIKEEQAQ 124
Human 125 TGQPAGLSQPP------APPQIYPWMTKLHMSHETDGKRSRTSYTRYQTLELEKEFHFNRYLTRR 183
Human 184 RRIEIANNLCLNERQIKIWFQNRRMKWKKDSKMKSK 219 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HOXC5 | NP_061826.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 68..141 | 23/133 (17%) | |
Antp-type hexapeptide | 140..145 | 3/4 (75%) | |||
Homeobox | 158..211 | CDD:306543 | 46/52 (88%) | ||
Antp | NP_996167.1 | KLF1_2_4_N | <161..306 | CDD:425360 | 30/145 (21%) |
Homeobox | 301..354 | CDD:395001 | 47/52 (90%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45659 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X14 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.910 |