DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXC5 and Antp

DIOPT Version :9

Sequence 1:NP_061826.1 Gene:HOXC5 / 3222 HGNCID:5127 Length:222 Species:Homo sapiens
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:361 Identity:100/361 - (27%)
Similarity:126/361 - (34%) Gaps:152/361 - (42%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSSYVANSF-------------------------YKQS---------PNIPAYNMQTCGNYGSAS 31
            |:||..||:                         |.|:         |..|.|:.....| |...
  Fly    11 MTSYFTNSYMGADMHHGHYPGNGVTDLDAQQMHHYSQNANHQGNMPYPRFPPYDRMPYYN-GQGM 74

Human    32 EVQASRYCYGGLDLSITFPPPAPSNSLHGV----------------------------------- 61
            :.|.....|.        .|.:||:.:.||                                   
  Fly    75 DQQQQHQVYS--------RPDSPSSQVGGVMPQAQTNGQLGVPQQQQQQQQQPSQNQQQQQAQQA 131

Human    62 ------------DMAANPRAHPDRP----ACSAAAAPG--------------------------- 83
                        ....:|:....:|    :|...||.|                           
  Fly   132 PQQLQQQLPQVTQQVTHPQQQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMT 196

Human    84 --HAPGRDEA--------AP---------LNPGMYSQKAARPALEE-----RAKSSGEIKEEQAQ 124
              |..|..:|        .|         .|.|||.|::..|.:..     ..:..|..:..|..
  Fly   197 LPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGH 261

Human   125 TGQPAGLSQPP------APPQIYPWMTKLHMSHETDGKRSRTSYTRYQTLELEKEFHFNRYLTRR 183
            .||....||.|      .|..:|||| :.......:.||.|.:||||||||||||||||||||||
  Fly   262 PGQHTPPSQNPNSQSSGMPSPLYPWM-RSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRR 325

Human   184 RRIEIANNLCLNERQIKIWFQNRRMKWKKDSKMKSK 219
            ||||||:.|||.|||||||||||||||||::|.|.:
  Fly   326 RRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGE 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXC5NP_061826.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..141 23/133 (17%)
Antp-type hexapeptide 140..145 3/4 (75%)
Homeobox 158..211 CDD:306543 46/52 (88%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 30/145 (21%)
Homeobox 301..354 CDD:395001 47/52 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.