DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXC5 and unpg

DIOPT Version :9

Sequence 1:NP_061826.1 Gene:HOXC5 / 3222 HGNCID:5127 Length:222 Species:Homo sapiens
Sequence 2:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster


Alignment Length:250 Identity:68/250 - (27%)
Similarity:90/250 - (36%) Gaps:92/250 - (36%)


- Green bases have known domain annotations that are detailed below.


Human    51 PPAPSNSLHGVDMAANP--------RAHPDRPACSAAAAPGHAPGRDEAAPLNPGMYSQKAARPA 107
            ||.|....|.::....|        |..|..|| :|..||.....|..|..:|.......:....
  Fly   131 PPPPHPPTHALEKQLPPTLPHPLDTRFLPFNPA-AAGVAPTDLSYRRLAELMNQDYVHSLSVHAR 194

Human   108 LEERAKSSGEIKEEQAQTGQPAGLSQPPAPPQIYPWMTK-------------------------- 146
            |:..| ::|.:.|:||..|. |.| |.|.|||.:....|                          
  Fly   195 LQHMA-AAGRMHEDQANPGM-AQL-QEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSC 256

Human   147 ----LHMS---------------------------------HETDG-----------------KR 157
                |.||                                 ||..|                 :|
  Fly   257 SDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRR 321

Human   158 SRTSYTRYQTLELEKEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKK 212
            .||::|..|.||||:|||..:||:...|.:||.:|.|:|.|:||||||||.|||:
  Fly   322 RRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXC5NP_061826.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..141 24/72 (33%)
Antp-type hexapeptide 140..145 0/4 (0%)
Homeobox 158..211 CDD:306543 29/52 (56%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 28/50 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.