DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tomosyn and Stxbp6

DIOPT Version :9

Sequence 1:NP_001162735.1 Gene:Tomosyn / 32217 FlyBaseID:FBgn0030412 Length:1470 Species:Drosophila melanogaster
Sequence 2:NP_653135.2 Gene:Stxbp6 / 217517 MGIID:2384963 Length:210 Species:Mus musculus


Alignment Length:218 Identity:60/218 - (27%)
Similarity:89/218 - (40%) Gaps:49/218 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1272 LDTDFLPLMELSFQTKCKQGIVDPMLSIWGQQIIVHEDTTQISKIFCFSHKGHGLYMASPTEIQK 1336
            ||...|..:::..:||.|    .|.|:..||    .|..|.|    |.|........||.|::::
Mouse    15 LDERMLGAIQVKRRTKKK----IPFLATGGQ----GEYLTYI----CLSVTNKKPTQASITKVKQ 67

  Fly  1337 FTISSEF---CQFILEMMGELYTVHEMPEQPKEGF---FKGLFGGGAK----------------- 1378
            |..|:.|   .|::||.:.::..:.  |.:....|   |:..|.....                 
Mouse    68 FEGSTSFVRRSQWMLEQLRQVNGID--PNRDSAEFDLLFENAFDQWVASTASEKCTFFQILHHTC 130

  Fly  1379 ---LLDREELFGEQSGKPNRSVARHIPGPNLEQLGQRASTAASEISRAHQLAMERGEKLNLLEER 1440
               |.||:..|.....|        |.|.| ..|...|.:..|.:.:|.|...||||:|...||:
Mouse   131 QRYLTDRKPEFINCQSK--------IMGGN-SILHSAADSVTSAVQKASQALNERGERLGRAEEK 186

  Fly  1441 AERMANTAQDFSGTAHQLMLKYK 1463
            .|.|.|:||.|:.|||:|.:|:|
Mouse   187 TEDMKNSAQQFAETAHKLAMKHK 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TomosynNP_001162735.1 WD40 52..257 CDD:295369
WD40 <55..257 CDD:225201
WD40 repeat 95..133 CDD:293791
WD40 repeat 138..184 CDD:293791
WD40 repeat 192..226 CDD:293791
LLGL 269..375 CDD:285555
R-SNARE_STXBP5_6 1403..1463 CDD:277226 25/59 (42%)
Stxbp6NP_653135.2 PH-STXBP6 2..131 CDD:270200 28/129 (22%)
R-SNARE_STXBP6 149..210 CDD:277245 26/62 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1983
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.