DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tomosyn and stxbp6l

DIOPT Version :10

Sequence 1:NP_727628.3 Gene:Tomosyn / 32217 FlyBaseID:FBgn0030412 Length:1470 Species:Drosophila melanogaster
Sequence 2:XP_073788098.1 Gene:stxbp6l / 100002110 ZFINID:ZDB-GENE-040724-16 Length:279 Species:Danio rerio


Alignment Length:82 Identity:25/82 - (30%)
Similarity:44/82 - (53%) Gaps:10/82 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1381 DREELFGEQSGKPNRSVARHIPG-PNLEQLGQRASTAASEISRAHQLAMERGEKLNLLEERAERM 1444
            ||.:  .|.:||.:||.::..|. |.:.::|       :.:.||.|:..||||:|...:::...|
Zfish   205 DRRQ--REAAGKSSRSRSKSSPSPPAVRKMG-------NVMRRASQVLSERGERLMKADDKTSHM 260

  Fly  1445 ANTAQDFSGTAHQLMLK 1461
            .:.|:.|:..|.:|.||
Zfish   261 LHGARHFAEAAQRLALK 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TomosynNP_727628.3 WD40 <41..257 CDD:441893
WD40 repeat 95..133 CDD:293791
WD40 repeat 138..184 CDD:293791
WD40 repeat 192..226 CDD:293791
LLGL 268..376 CDD:462446
R-SNARE_STXBP5_6 1403..1463 CDD:277226 17/60 (28%)
stxbp6lXP_073788098.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.