DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2540 and AT1G44790

DIOPT Version :9

Sequence 1:NP_572818.1 Gene:CG2540 / 32216 FlyBaseID:FBgn0030411 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_564490.1 Gene:AT1G44790 / 841043 AraportID:AT1G44790 Length:199 Species:Arabidopsis thaliana


Alignment Length:192 Identity:82/192 - (42%)
Similarity:121/192 - (63%) Gaps:18/192 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 VWIFGYGSLVWKTDFPYIDRRRGFVWGFKRRFYQHSIDHRGIPERPGRVVTLLPGDPAQDRV-YG 137
            :|:||||||:|||.||:.:...||:.|::|.|:|.|.||||.|:.|||.|||   :.|.:.| .|
plant     3 MWVFGYGSLIWKTGFPFDESLPGFIKGYRRVFHQGSTDHRGTPDFPGRTVTL---EAAHEEVCCG 64

  Fly   138 VAYRIAASQ-KGAVLDHLDYREKNGYERCSLEFHEYPTD--GAEP--IQVIMYVAT---QANDSY 194
            |||:|...: |...|.||:.|||. |::  .|:.::.||  .:||  ..|::|:|:   ::|::|
plant    65 VAYKITKEEDKRDALLHLEVREKQ-YDQ--KEYLDFFTDSNASEPAVAGVMVYIASPDKKSNNNY 126

  Fly   195 AGDVWQVPCIARQIFSSAGPSGPNREYLFNLAAAMDQLFPGAVDEHLEELVACVKRYIVEDE 256
            .|.. .:..||:||..:.|||||||:|||||..|:.||  |..|:|:.:|...|:..:.|.|
plant   127 LGPA-PLEDIAKQIVKAKGPSGPNRDYLFNLEEALAQL--GFKDKHVTDLANQVRHILSESE 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2540NP_572818.1 ChaC 74..251 CDD:282590 80/185 (43%)
AT1G44790NP_564490.1 ChaC 3..178 CDD:282590 79/183 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 128 1.000 Domainoid score I1745
eggNOG 1 0.900 - - E1_COG3703
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H48696
Inparanoid 1 1.050 130 1.000 Inparanoid score I1879
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1238273at2759
OrthoFinder 1 1.000 - - FOG0001482
OrthoInspector 1 1.000 - - otm3399
orthoMCL 1 0.900 - - OOG6_101165
Panther 1 1.100 - - LDO PTHR12192
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X941
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.