DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2540 and AT5G26220

DIOPT Version :9

Sequence 1:NP_572818.1 Gene:CG2540 / 32216 FlyBaseID:FBgn0030411 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_197994.1 Gene:AT5G26220 / 832691 AraportID:AT5G26220 Length:216 Species:Arabidopsis thaliana


Alignment Length:224 Identity:72/224 - (32%)
Similarity:107/224 - (47%) Gaps:35/224 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 VWIFGYGSLVWKTDFPYIDRRRGFVWGFKRRFYQHSIDHRGIPERPGRVVTLLPGDPAQDRVYGV 138
            :|:||||||:|...|.:.::..|::..:||.|....|||||.||.|.|..||.....|  ..:|.
plant     3 LWVFGYGSLIWNPGFDFDEKLIGYIKDYKRVFDLACIDHRGTPEHPARTCTLEQSTGA--ICWGA 65

  Fly   139 AY--RIAASQKGAVLDHLDYREKNGYERCSLEFHEYPTDGAEPIQVIMYVATQANDSYAGDVWQV 201
            ||  |....::...:::|:.||.....:..:||:. ..|.:.||...:.|.|...|..:...:..
plant    66 AYCVRGGPEKEKLAMEYLERRECEYDSKTLVEFYT-ENDTSTPIVTGVIVFTSTPDKVSNKYYLG 129

  Fly   202 PC----IARQIFSSAGPSGPNREYLFNLAAAMDQLFPGAVDEHLEELVACVKRYIVE-------- 254
            |.    :||||.:::||.|.||||||.|..||..:      ||.||       |::|        
plant   130 PAPLEEMARQIATASGPCGNNREYLFKLEKAMFDI------EHEEE-------YVIELANEVRKQ 181

  Fly   255 -DEPQLIRHALLHEISGILEEEQLAEQAH 282
             |.|:.:: |||   ..|:....:..|||
plant   182 LDLPEEVK-ALL---KPIVSHVSVKSQAH 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2540NP_572818.1 ChaC 74..251 CDD:282590 61/182 (34%)
AT5G26220NP_197994.1 GGCT_like 3..181 CDD:419880 63/193 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3703
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1238273at2759
OrthoFinder 1 1.000 - - FOG0001482
OrthoInspector 1 1.000 - - otm3399
orthoMCL 1 0.900 - - OOG6_101165
Panther 1 1.100 - - O PTHR12192
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X941
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.780

Return to query results.
Submit another query.