DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2540 and Chac1

DIOPT Version :9

Sequence 1:NP_572818.1 Gene:CG2540 / 32216 FlyBaseID:FBgn0030411 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_081205.1 Gene:Chac1 / 69065 MGIID:1916315 Length:223 Species:Mus musculus


Alignment Length:211 Identity:89/211 - (42%)
Similarity:111/211 - (52%) Gaps:29/211 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ENSNQLEPPAAT------------DAD---VWIFGYGSLVWKTDFPYIDRRRGFVWGFKRRFYQH 108
            |:::|..||.:.            |.|   :|||||||||||.||.|.|.|.|||.|:.|||:|.
Mouse     4 ESASQSTPPPSLSPAPSSAQPSWGDGDPQALWIFGYGSLVWKPDFAYSDSRVGFVRGYSRRFWQG 68

  Fly   109 SIDHRGIPERPGRVVTLLPGDPAQDR---VYGVAYRIAASQKGAVLDHLDYREK--NGYERCSLE 168
            ...|||..:.||||||||     :||   .:||||::...|....|.:|:.||.  .||:...:.
Mouse    69 DTFHRGSDKMPGRVVTLL-----EDREGCTWGVAYQVRGEQVNEALKYLNVREAVLGGYDTKEVT 128

  Fly   169 FHEYPTDGA-EPIQVIMYVATQANDSYAGDVWQVPCIARQIFSSAGPSGPNREYLFNLAAAMDQL 232
            |  ||.|.. :|:..:.||||..|..|.|...: ..||.||.:..|.||.|.|||..||..|...
Mouse   129 F--YPQDTPDQPLTALAYVATPQNPGYLGPAPE-EVIATQILACRGFSGHNLEYLLRLADFMQLC 190

  Fly   233 FPGAVDEHLEELVACV 248
            .|.|.|||||.:|..|
Mouse   191 GPQAQDEHLEAIVDAV 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2540NP_572818.1 ChaC 74..251 CDD:282590 83/181 (46%)
Chac1NP_081205.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 4/21 (19%)
ChaC 34..209 CDD:282590 83/181 (46%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:O75223 36..41 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001482
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101165
Panther 1 1.100 - - O PTHR12192
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R197
SonicParanoid 1 1.000 - - X941
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.