DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2540 and chac1

DIOPT Version :9

Sequence 1:NP_572818.1 Gene:CG2540 / 32216 FlyBaseID:FBgn0030411 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001103596.2 Gene:chac1 / 563855 ZFINID:ZDB-GENE-030131-1957 Length:196 Species:Danio rerio


Alignment Length:182 Identity:73/182 - (40%)
Similarity:97/182 - (53%) Gaps:6/182 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 ATDADVWIFGYGSLVWKTDFPYIDRRRGFVWGFKRRFYQHSIDHRGIPERPGRVVTLLPGDPAQD 133
            |..:.:|||||||||||.||.|...:.|::.|:||||:.....|||..|.|||||||:..|..  
Zfish     8 AGKSSLWIFGYGSLVWKPDFKYKRSKVGYIKGYKRRFWHGDNFHRGDDEMPGRVVTLIEEDDV-- 70

  Fly   134 RVYGVAYRIAASQKGAVLDHLDYRE--KNGYERCSLEFHEYPTDGAEPIQVIMYVATQANDSYAG 196
            ..:|||:.:..||....|.:|:.||  :.||...:::|....|: ..|:|.::|:||..|..|.|
Zfish    71 CTWGVAFEVTGSQMEESLKYLNVREAVRGGYLTRAVDFFPRGTN-QPPVQALVYIATPDNPIYLG 134

  Fly   197 DVWQVPCIARQIFSSAGPSGPNREYLFNLAAAMDQLFPGAVDEHLEELVACV 248
            .. ....||.||....|.||.|.|||..||..|....|...|.||..:.|.:
Zfish   135 PA-STEEIASQIAVCKGNSGHNIEYLLRLAEFMRVSCPDVDDPHLFSIEAAL 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2540NP_572818.1 ChaC 74..251 CDD:282590 72/177 (41%)
chac1NP_001103596.2 ChaC 5..190 CDD:226226 73/182 (40%)
ChaC 13..183 CDD:282590 71/173 (41%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:O75223 15..20 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1238273at2759
OrthoFinder 1 1.000 - - FOG0001482
OrthoInspector 1 1.000 - - otm25099
orthoMCL 1 0.900 - - OOG6_101165
Panther 1 1.100 - - O PTHR12192
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R197
SonicParanoid 1 1.000 - - X941
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.850

Return to query results.
Submit another query.