DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2540 and chac2

DIOPT Version :9

Sequence 1:NP_572818.1 Gene:CG2540 / 32216 FlyBaseID:FBgn0030411 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001025128.1 Gene:chac2 / 557614 ZFINID:ZDB-GENE-050706-146 Length:182 Species:Danio rerio


Alignment Length:179 Identity:89/179 - (49%)
Similarity:121/179 - (67%) Gaps:7/179 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 VWIFGYGSLVWKTDFPYIDRRRGFVWGFKRRFYQHSIDHRGIPERPGRVVTLLPGDPAQDRVYGV 138
            :|:||||||:||.||||.|:|.|||.||.|||:|.|.||||:|.:|||||||:. || :..|:||
Zfish     1 MWVFGYGSLIWKVDFPYEDKRVGFVKGFSRRFWQGSTDHRGVPGKPGRVVTLIE-DP-EGCVWGV 63

  Fly   139 AYRIAASQKGAVLDHLDYREKNGYERCSLEFHEYPTD-GAEPIQ-VIMYVATQANDSYAGDVWQV 201
            ||::.:.|:..|.::||||||.||...::.||  |.| ..:|:| .::|:.:..|.:|.|.. .:
Zfish    64 AYKLPSGQEQEVKEYLDYREKGGYGVITVTFH--PKDEQQQPMQDTLLYIGSCDNPNYLGPA-PL 125

  Fly   202 PCIARQIFSSAGPSGPNREYLFNLAAAMDQLFPGAVDEHLEELVACVKR 250
            ..||:||..|.||||.|.:|||.||.|:.||.|..:|:||..|...||:
Zfish   126 ETIAQQIVKSVGPSGKNTDYLFELADALRQLVPEDLDDHLFSLERLVKQ 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2540NP_572818.1 ChaC 74..251 CDD:282590 89/179 (50%)
chac2NP_001025128.1 ChaC 1..175 CDD:282590 89/179 (50%)
ChaC 2..178 CDD:226226 89/178 (50%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:O75223 3..8 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581681
Domainoid 1 1.000 165 1.000 Domainoid score I3884
eggNOG 1 0.900 - - E1_COG3703
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H48696
Inparanoid 1 1.050 165 1.000 Inparanoid score I4173
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1238273at2759
OrthoFinder 1 1.000 - - FOG0001482
OrthoInspector 1 1.000 - - otm25099
orthoMCL 1 0.900 - - OOG6_101165
Panther 1 1.100 - - LDO PTHR12192
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R197
SonicParanoid 1 1.000 - - X941
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.830

Return to query results.
Submit another query.