DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2540 and chac2

DIOPT Version :9

Sequence 1:NP_572818.1 Gene:CG2540 / 32216 FlyBaseID:FBgn0030411 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001017137.1 Gene:chac2 / 549891 XenbaseID:XB-GENE-5817326 Length:184 Species:Xenopus tropicalis


Alignment Length:180 Identity:81/180 - (45%)
Similarity:114/180 - (63%) Gaps:6/180 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 VWIFGYGSLVWKTDFPYIDRRRGFVWGFKRRFYQHSIDHRGIPERPGRVVTLLPGDPAQDRVYGV 138
            :|:||||||:||.||||:::..|::..:.|||:|.|.||||:|.:|||||||:. || :..|:||
 Frog     1 MWVFGYGSLIWKVDFPYVEKLVGYITCYSRRFWQGSTDHRGVPGKPGRVVTLVE-DP-EGCVWGV 63

  Fly   139 AYRIAASQKGAVLDHLDYREKNGYERCSLEFHEYPTD-GAEPIQVIMYVATQANDSYAGDVWQVP 202
            |||:...::..|..:||:|||.||...:..|  ||.| ..:|..|::|:.|..|..|.|.. .:.
 Frog    64 AYRLPEGKEEEVKAYLDFREKGGYRTSTGVF--YPKDPSIKPFNVLLYIGTCDNPDYLGPA-PLE 125

  Fly   203 CIARQIFSSAGPSGPNREYLFNLAAAMDQLFPGAVDEHLEELVACVKRYI 252
            .||.||.::.||||.|.||||.||.::..|.|...||||..|...|::.:
 Frog   126 DIAEQILNAVGPSGRNTEYLFELANSLRNLVPEDADEHLFSLERLVRQLL 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2540NP_572818.1 ChaC 74..251 CDD:282590 81/177 (46%)
chac2NP_001017137.1 ChaC 1..174 CDD:368097 81/177 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H48696
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1238273at2759
OrthoFinder 1 1.000 - - FOG0001482
OrthoInspector 1 1.000 - - oto104210
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R197
SonicParanoid 1 1.000 - - X941
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.040

Return to query results.
Submit another query.