DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2540 and CHAC2

DIOPT Version :9

Sequence 1:NP_572818.1 Gene:CG2540 / 32216 FlyBaseID:FBgn0030411 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001008708.1 Gene:CHAC2 / 494143 HGNCID:32363 Length:184 Species:Homo sapiens


Alignment Length:177 Identity:86/177 - (48%)
Similarity:114/177 - (64%) Gaps:6/177 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 VWIFGYGSLVWKTDFPYIDRRRGFVWGFKRRFYQHSIDHRGIPERPGRVVTLLPGDPAQDRVYGV 138
            :|:||||||:||.||||.|:..|::..:.|||:|.|.||||:|.:|||||||:. ||| ..|:||
Human     1 MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVE-DPA-GCVWGV 63

  Fly   139 AYRIAASQKGAVLDHLDYREKNGYERCSLEFHEYPTD-GAEPIQVIMYVATQANDSYAGDVWQVP 202
            |||:...::..|..:||:|||.||...::.|  ||.| ..:|..|::|:.|..|..|.|.. .:.
Human    64 AYRLPVGKEEEVKAYLDFREKGGYRTTTVIF--YPKDPTTKPFSVLLYIGTCDNPDYLGPA-PLE 125

  Fly   203 CIARQIFSSAGPSGPNREYLFNLAAAMDQLFPGAVDEHLEELVACVK 249
            .||.|||::|||||.|.||||.||.::..|.|...||||..|...||
Human   126 DIAEQIFNAAGPSGRNTEYLFELANSIRNLVPEEADEHLFALEKLVK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2540NP_572818.1 ChaC 74..251 CDD:282590 86/177 (49%)
CHAC2NP_001008708.1 ChaC 1..174 CDD:368097 86/177 (49%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:O75223 3..8 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147809
Domainoid 1 1.000 160 1.000 Domainoid score I4066
eggNOG 1 0.900 - - E1_COG3703
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H48696
Inparanoid 1 1.050 160 1.000 Inparanoid score I4255
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1238273at2759
OrthoFinder 1 1.000 - - FOG0001482
OrthoInspector 1 1.000 - - oto90404
orthoMCL 1 0.900 - - OOG6_101165
Panther 1 1.100 - - LDO PTHR12192
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R197
SonicParanoid 1 1.000 - - X941
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1514.830

Return to query results.
Submit another query.