DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2540 and CG10365

DIOPT Version :9

Sequence 1:NP_572818.1 Gene:CG2540 / 32216 FlyBaseID:FBgn0030411 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_651176.1 Gene:CG10365 / 42801 FlyBaseID:FBgn0039109 Length:284 Species:Drosophila melanogaster


Alignment Length:233 Identity:85/233 - (36%)
Similarity:122/233 - (52%) Gaps:27/233 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 NSNQLEPPAATDADVWIFGYGSLVWKTDFPYIDRRRGFVWGFKRRFYQHSIDHRGIPERPGRVVT 124
            |:|...|   :|...|:||||||.|...|.|.....|::.|:.|||:|.::.|||..|:||||.|
  Fly    46 NNNNAGP---SDPACWVFGYGSLCWHPGFNYTKCITGYIRGYVRRFWQGNVTHRGCEEKPGRVAT 107

  Fly   125 LLPGDPAQDRVYGVAYRIAASQKGAVLDHLDYRE--KNGYERCSLEF------HEYPTDGAEPIQ 181
            |:  :..:...:|.||||..|   ..||:|..||  ..||.....:|      .:.|..| |.::
  Fly   108 LV--EDKEGITWGCAYRITGS---TALDYLKQRECTLGGYATIDTKFFPRVASQDTPFSG-EAVE 166

  Fly   182 VIMYVATQANDSYAGDVWQVPCIARQIFSSAGPSGPNREYLFNLAAAMDQLFPGAVDEHLEELVA 246
            |::||||..|..:.||. .|..||:||.|..||||.|.|||..||..|.:..||..|:||.||  
  Fly   167 VLVYVATPENIYWLGDD-PVEEIAQQIVSCRGPSGHNAEYLLRLALFMHEEIPGVRDDHLFEL-- 228

  Fly   247 CVKRYIVEDEPQLIRHAL-LHEISGILEEEQLAEQAHQ 283
              ::.::|   :|.|..: |..:.| ...:::...:|:
  Fly   229 --EQLVLE---ELYRRQIPLSSVMG-RNPDRIRRDSHE 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2540NP_572818.1 ChaC 74..251 CDD:282590 75/184 (41%)
CG10365NP_651176.1 ChaC 57..224 CDD:282590 71/173 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449997
Domainoid 1 1.000 80 1.000 Domainoid score I456
eggNOG 1 0.900 - - E1_COG3703
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I363
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D108535at50557
OrthoFinder 1 1.000 - - FOG0001482
OrthoInspector 1 1.000 - - otm51434
orthoMCL 1 0.900 - - OOG6_101165
Panther 1 1.100 - - P PTHR12192
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R197
SonicParanoid 1 1.000 - - X941
1211.830

Return to query results.
Submit another query.