DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2540 and Chac1

DIOPT Version :9

Sequence 1:NP_572818.1 Gene:CG2540 / 32216 FlyBaseID:FBgn0030411 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001166908.1 Gene:Chac1 / 362196 RGDID:1307153 Length:222 Species:Rattus norvegicus


Alignment Length:207 Identity:87/207 - (42%)
Similarity:109/207 - (52%) Gaps:22/207 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ENSNQLEPPAA-----------TDAD---VWIFGYGSLVWKTDFPYIDRRRGFVWGFKRRFYQHS 109
            |::.|..||.:           .|.|   :|||||||||||.||.|.|.|.|||.|:.|||:|..
  Rat     4 ESAAQSTPPPSLSPAPSAQPSWEDGDPQALWIFGYGSLVWKPDFAYSDSRVGFVRGYSRRFWQGD 68

  Fly   110 IDHRGIPERPGRVVTLLPGDPAQDRVYGVAYRIAASQKGAVLDHLDYREK--NGYERCSLEFHEY 172
            ..|||..:.||||||||  :..:...:||||::...|....|.:|:.||.  .||:...:.|  |
  Rat    69 TFHRGSDKMPGRVVTLL--EDHEGCTWGVAYQVRGEQVSEALKYLNVREAVLGGYDTKEVTF--Y 129

  Fly   173 PTDGA-EPIQVIMYVATQANDSYAGDVWQVPCIARQIFSSAGPSGPNREYLFNLAAAMDQLFPGA 236
            |.|.. :|:..:.||||..|..|.|...: ..||.||.:..|.||.|.|||..||..|....|.|
  Rat   130 PQDTPDQPLTALAYVATPQNPGYLGPAPE-EVIATQILACRGFSGHNLEYLLRLADFMQLCGPQA 193

  Fly   237 VDEHLEELVACV 248
            .|||||.:|..|
  Rat   194 QDEHLEAIVDAV 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2540NP_572818.1 ChaC 74..251 CDD:282590 81/178 (46%)
Chac1NP_001166908.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25 4/20 (20%)
ChaC 33..208 CDD:398428 81/178 (46%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:O75223 35..40 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1238273at2759
OrthoFinder 1 1.000 - - FOG0001482
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101165
Panther 1 1.100 - - O PTHR12192
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X941
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.