DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2540 and Chac2

DIOPT Version :9

Sequence 1:NP_572818.1 Gene:CG2540 / 32216 FlyBaseID:FBgn0030411 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001020187.1 Gene:Chac2 / 360994 RGDID:1309120 Length:178 Species:Rattus norvegicus


Alignment Length:177 Identity:84/177 - (47%)
Similarity:115/177 - (64%) Gaps:6/177 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 VWIFGYGSLVWKTDFPYIDRRRGFVWGFKRRFYQHSIDHRGIPERPGRVVTLLPGDPAQDRVYGV 138
            :|:||||||:||.||||.|:..|::..:.|||:|.|.||||:|.:|||||||:. ||. ..|:||
  Rat     1 MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVE-DPG-GSVWGV 63

  Fly   139 AYRIAASQKGAVLDHLDYREKNGYERCSLEFHEYPTDG-AEPIQVIMYVATQANDSYAGDVWQVP 202
            ||::...::..|..:||:|||.||...::.|  ||.|. .:|..|::|:.|..|.:|.|.. .:.
  Rat    64 AYKLPVGKEEEVKTYLDFREKGGYRTTTVIF--YPKDSTTKPFSVLLYIGTCDNPNYLGPA-PLE 125

  Fly   203 CIARQIFSSAGPSGPNREYLFNLAAAMDQLFPGAVDEHLEELVACVK 249
            .||.|||::|||||.|.||||.||.::.:|.|...||||..|...||
  Rat   126 DIAEQIFNAAGPSGRNTEYLFELADSIRKLVPEDADEHLFSLEKLVK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2540NP_572818.1 ChaC 74..251 CDD:282590 84/177 (47%)
Chac2NP_001020187.1 ChaC 1..174 CDD:398428 84/177 (47%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:O75223 3..8 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341667
Domainoid 1 1.000 160 1.000 Domainoid score I3971
eggNOG 1 0.900 - - E1_COG3703
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H48696
Inparanoid 1 1.050 160 1.000 Inparanoid score I4152
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001482
OrthoInspector 1 1.000 - - oto97517
orthoMCL 1 0.900 - - OOG6_101165
Panther 1 1.100 - - LDO PTHR12192
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X941
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.