DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2540 and F22F7.7

DIOPT Version :9

Sequence 1:NP_572818.1 Gene:CG2540 / 32216 FlyBaseID:FBgn0030411 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_503578.1 Gene:F22F7.7 / 178693 WormBaseID:WBGene00017724 Length:232 Species:Caenorhabditis elegans


Alignment Length:187 Identity:65/187 - (34%)
Similarity:98/187 - (52%) Gaps:19/187 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 AATDADVWIFGYGSLVWKTDFPYIDRRRGFVWGFKRRFYQHSIDHRGIPERPGRVVTLLPGDPAQ 132
            ::|...:||||||||:|...|.:...|:.:..|:.||.||.:..|||..:.||||.||:  :...
 Worm    44 SSTSQSLWIFGYGSLIWNPGFTFSTSRKAYAIGWARRMYQGNTYHRGDEKLPGRVATLI--EETN 106

  Fly   133 DRVYGVAYRI-AASQKGAVLDHLDYRE-KNGYE------RCSLEFHEYPTDGAEPIQVIMYVATQ 189
            ....||.:|: ..|.....:.:|:.|| .|||.      :.....|..||    .:..:..||.|
 Worm   107 SYTNGVVFRVDGKSAIATAVKYLEQRECDNGYAFRMVPVQIRSAAHRRPT----VVMALTCVADQ 167

  Fly   190 ANDSYAG--DVWQVPCIARQIFSSAGPSGPNREYLFNLAAAMDQLFPGAVDEHLEEL 244
            .|:.|.|  |:.:   :||:|.::.|.:|||.||:.|||..:.:|||...|:||.:|
 Worm   168 QNELYLGPDDLIK---MAREIVTAKGCAGPNCEYVLNLAENLRKLFPNDEDDHLFQL 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2540NP_572818.1 ChaC 74..251 CDD:282590 64/181 (35%)
F22F7.7NP_503578.1 ChaC 50..230 CDD:226226 64/181 (35%)
ChaC 50..228 CDD:282590 64/181 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1238273at2759
OrthoFinder 1 1.000 - - FOG0001482
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101165
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R197
SonicParanoid 1 1.000 - - X941
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.