DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aven and Aven

DIOPT Version :9

Sequence 1:NP_001285162.1 Gene:Aven / 32215 FlyBaseID:FBgn0030410 Length:294 Species:Drosophila melanogaster
Sequence 2:XP_006234769.1 Gene:Aven / 311299 RGDID:1309928 Length:342 Species:Rattus norvegicus


Alignment Length:311 Identity:67/311 - (21%)
Similarity:105/311 - (33%) Gaps:89/311 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 RRGNWQSSGAGRSSLAPQRNR-------DMLDTLPSDTDDVEQLGLDGAPIDENARAQL------ 109
            |||..:....||...||:..|       ....|...:..|.|..|.:.......:|.::      
  Rat    44 RRGRGRGFRRGRGGGAPRGGRREPGGRGGGASTRVEEDSDSETYGEENDEQGHFSRRKIVSNWDR 108

  Fly   110 ----------------RAGDFQQLAQFPSLGGGHFTFGSEREWANVAEGQTKLHTKAASAYF-TL 157
                            |..||..|..........|.|..|:||    :|:|....:.::.|. :.
  Rat   109 YQDTEKEVNGESGESQRGTDFSVLLSSAGDSFSQFRFAEEKEW----DGETSCSKQNSALYVDSE 169

  Fly   158 NLTRLNVGLQTIPLYKRMDYPASLFTRAQIAAQEKAAERAEAVYQQ---------CILKDANGG- 212
            :|.|   .||.:||..|::..:.|...|......:|..|.....::         ..|:.|.|| 
  Rat   170 SLVR---ALQQLPLAVRLNVASELIQTAVPLELPQAKPRRNDDGKELGMQLRGPLSQLRSAAGGC 231

  Fly   213 -------AKSRAPSAKSNKDVAPAAAEKPIAASAAEPDELDELLAM------------TDTQLD- 257
                   :..::||..|.|     |:..|.:|:....:|||.||.:            ..|..| 
  Rat   232 PRSLGRDSLRQSPSEGSQK-----ASSPPQSAADHLEEELDMLLHLDAPVKEEDSLSPDQTSQDQ 291

  Fly   258 -------IGSGTITMPMPMV---------QPATPSSAASKNGVEEWLDSVL 292
                   |....|....|.|         ||:| |...::..:|:||||::
  Rat   292 EPERDGQIAQEEIAPEKPSVTRDKTVEPGQPST-SKTVTEEELEDWLDSMI 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AvenNP_001285162.1 PRK12278 <180..>248 CDD:237034 18/84 (21%)
AvenXP_006234769.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BBSX
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR16524
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.