powered by:
Protein Alignment CG11085 and HMRA1
DIOPT Version :9
Sequence 1: | NP_572815.3 |
Gene: | CG11085 / 32213 |
FlyBaseID: | FBgn0030408 |
Length: | 295 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_010021.1 |
Gene: | HMRA1 / 850459 |
SGDID: | S000000694 |
Length: | 126 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 68 |
Identity: | 19/68 - (27%) |
Similarity: | 40/68 - (58%) |
Gaps: | 4/68 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 149 HKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRT 213
|.::..|| |:.:.:....|: |:||:.||.::.|:..::.:||:...::..||:.|:.|:|.
Yeast 63 HHIKKEKS---PKGKSSISPQAR-AFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRM 123
Fly 214 KWK 216
:.|
Yeast 124 RSK 126
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG11085 | NP_572815.3 |
Homeobox |
163..216 |
CDD:278475 |
14/52 (27%) |
HMRA1 | NP_010021.1 |
HOX |
70..126 |
CDD:197696 |
16/59 (27%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
41 |
1.000 |
Domainoid score |
I3229 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.