DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and NKX6-2

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_796374.2 Gene:NKX6-2 / 84504 HGNCID:19321 Length:277 Species:Homo sapiens


Alignment Length:225 Identity:62/225 - (27%)
Similarity:97/225 - (43%) Gaps:58/225 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 HDESSVESCL--SATRGPGS---------------GTGSG-----GGGGGGGGGGVASG---LSA 105
            |:.:.:::.|  .|.:||..               ||..|     |...|..|||:..|   |:.
Human    20 HNMAEMKTSLFPYALQGPAGFKAPALGGLGAQLPLGTPHGISDILGRPVGAAGGGLLGGLPRLNG 84

  Fly   106 AAAAAGVAAGLLAAAASG-------------------ANGD--RDANGGSGPGSGGGTSGGYAEH 149
            .|::|||..|..||.|.|                   ..|.  ||.. .:||...||.       
Human    85 LASSAGVYFGPAAAVARGYPKPLAELPGRPPIFWPGVVQGAPWRDPR-LAGPAPAGGV------- 141

  Fly   150 KLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTK 214
               |.|.|:|...|.| |:..|:..||:.|...|||:..:|:.:|.:|.::|:|||.|:||||||
Human   142 ---LDKDGKKKHSRPT-FSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTK 202

  Fly   215 WKRQNQLRLEQLRHQATMEKDFVVQDGGGA 244
            |::::.:.:...:.:...:.:.:...|..|
Human   203 WRKRHAVEMASAKKKQDSDAEKLKVGGSDA 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 24/52 (46%)
NKX6-2NP_796374.2 Repressor domain. /evidence=ECO:0000250|UniProtKB:D3Z4R4 89..142 15/63 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 132..155 10/33 (30%)
Homeobox 151..204 CDD:306543 24/53 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..250 2/23 (9%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.