DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and ATHB13

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_177136.1 Gene:ATHB13 / 843314 AraportID:AT1G69780 Length:294 Species:Arabidopsis thaliana


Alignment Length:111 Identity:29/111 - (26%)
Similarity:42/111 - (37%) Gaps:22/111 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 GGSGPGSG------GGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADR 190
            |...|..|      |....|..::....|:.|.|.||    ....|:..||:.|.....|....:
plant    52 GKRSPMEGCCDLETGNNMNGEEDYSDDGSQMGEKKRR----LNMEQVKTLEKNFELGNKLEPERK 112

  Fly   191 SDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDF 236
            ..:|..|.|...|:..|:||||.:||.:.            :|||:
plant   113 MQLARALGLQPRQIAIWFQNRRARWKTKQ------------LEKDY 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 14/52 (27%)
ATHB13NP_177136.1 Homeobox 85..138 CDD:395001 17/56 (30%)
HALZ 140..182 CDD:396657 3/19 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.