DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and HB-1

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_174164.2 Gene:HB-1 / 839740 AraportID:AT1G28420 Length:1705 Species:Arabidopsis thaliana


Alignment Length:128 Identity:41/128 - (32%)
Similarity:62/128 - (48%) Gaps:27/128 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 SKSGR-KPRRR-RTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWK 216
            ||.|| ||:|: :|.|   ||..||:.:..:||.|.|.|::::|.|:||:.|::.|:.:||.|.|
plant    34 SKDGRVKPKRQMKTPF---QLETLEKVYSEEKYPSEATRAELSEKLDLSDRQLQMWFCHRRLKDK 95

  Fly   217 RQNQLRLEQLRHQATMEKDFVVQDGGGAGGL-------------GCCP---------SGLSSS 257
            :..|.........|.::...|.:....||.:             ||.|         ||.|||
plant    96 KDGQSNKPVKSSVAAVQSASVNELPAAAGSVPEQDSRSDSGSESGCSPYSNSRRNFASGSSSS 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 20/53 (38%)
HB-1NP_174164.2 Homeobox 42..95 CDD:278475 21/55 (38%)
DDT 550..605 CDD:280886
HARE-HTH 731..799 CDD:282869
WHIM1 934..979 CDD:292246
WHIM2 1100..1137 CDD:292247
WHIM3 1139..1172 CDD:292248
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.