DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and HB52

DIOPT Version :10

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_200209.1 Gene:HB52 / 835481 AraportID:AT5G53980 Length:156 Species:Arabidopsis thaliana


Alignment Length:86 Identity:25/86 - (29%)
Similarity:47/86 - (54%) Gaps:7/86 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 LQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKW 215
            ::.|:|..|.:::|  .|..|:..||:.|...|.|....:..::..|.|.:.||..|:||:|.::
plant     1 MENSQSQGKNKKKR--LTQDQVRQLEKCFTMNKKLEPDLKLQLSNQLGLPQRQVAVWFQNKRARF 63

  Fly   216 KRQNQLRLE----QLRHQATM 232
            |.|: |.::    |.:|:|.:
plant    64 KTQS-LEVQHCTLQSKHEAAL 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeodomain 161..217 CDD:459649 16/55 (29%)
HB52NP_200209.1 Homeodomain 11..64 CDD:459649 16/54 (30%)

Return to query results.
Submit another query.