DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and HAT2

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_199548.1 Gene:HAT2 / 834784 AraportID:AT5G47370 Length:283 Species:Arabidopsis thaliana


Alignment Length:125 Identity:35/125 - (28%)
Similarity:63/125 - (50%) Gaps:8/125 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 GVAA--GLLAAAASGANGDRDANGGSGPGSGGG-----TSGGYAEHKLQLSKSGRKPRRRRTAFT 168
            ||::  ..:::..||...:|:...|:|.|||..     ...||:.......:.|.:..|::...:
plant    71 GVSSPNSTISSTISGKRSEREGISGTGVGSGDDHDEITPDRGYSRGTSDEEEDGGETSRKKLRLS 135

  Fly   169 HAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWK-RQNQLRLEQLR 227
            ..|.|:||..|:....|:...:..:|:.|||:..||:.|:||||.:.| :|.::..|.|:
plant   136 KDQSAFLEETFKEHNTLNPKQKLALAKKLNLTARQVEVWFQNRRARTKLKQTEVDCEYLK 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 17/52 (33%)
HAT2NP_199548.1 HD-ZIP_N 8..91 CDD:398351 4/19 (21%)
HOX 129..183 CDD:197696 18/53 (34%)
HALZ 185..228 CDD:128634 3/11 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.