DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and HB-7

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001318750.1 Gene:HB-7 / 834733 AraportID:AT5G46880 Length:826 Species:Arabidopsis thaliana


Alignment Length:147 Identity:37/147 - (25%)
Similarity:52/147 - (35%) Gaps:48/147 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 GSGGGTSGGYAE----------------HKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYL 185
            ||.||:.|..:|                |..:.....:|.|..|  .|:.|:..:|..|:...:.
plant    74 GSAGGSFGSGSEQAEDPKFGNESDVNELHDDEQPPPAKKKRYHR--HTNRQIQEMEALFKENPHP 136

  Fly   186 SVADRSDVAETLNLSETQVKTWYQNRRTKWKRQ-------------NQLRLEQLRHQATMEKDFV 237
            ....|..::..|.|...|||.|:|||||:.|.|             :.|:.|....||.      
plant   137 DDKQRKRLSAELGLKPRQVKFWFQNRRTQMKAQQDRNENVMLRAENDNLKSENCHLQAE------ 195

  Fly   238 VQDGGGAGGLGC--CPS 252
                     |.|  |||
plant   196 ---------LRCLSCPS 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 17/52 (33%)
HB-7NP_001318750.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.