DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and HB-3

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_568309.2 Gene:HB-3 / 831367 AraportID:AT5G15150 Length:314 Species:Arabidopsis thaliana


Alignment Length:215 Identity:49/215 - (22%)
Similarity:77/215 - (35%) Gaps:49/215 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 EDRSTPDSTAAGCQQELLLSHH-------HRRFTHH--DESSVESC---LSATRGPGSGTGSGGG 90
            |:|:..::...|.:.|:....|       |....||  ..:|:.||   |..             
plant     6 EERNNINNNQEGLRLEMAFPQHGFMFQQLHEDNAHHLPSPTSLPSCPPHLFY------------- 57

  Fly    91 GGGGGGGGVASGLSAAAAAAGVAAGLLAAAASGAN--GDRDANGGSGPGSGGGTSGGYAEHKLQL 153
               ||||......|.:.........|...:.:..|  .|:|..|.....|..|:.....|.|.:|
plant    58 ---GGGGNYMMNRSMSFTGVSDHHHLTQKSPTTTNNMNDQDQVGEEDNLSDDGSHMMLGEKKKRL 119

  Fly   154 SKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQ 218
            :..              |:..||:.|.....|....:..:|:.|.|...|:..|:||||.:||.:
plant   120 NLE--------------QVRALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWKTK 170

  Fly   219 NQLRLEQLRHQATMEKDFVV 238
               :||  |...:::|.|.|
plant   171 ---QLE--RDYDSLKKQFDV 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 14/52 (27%)
HB-3NP_568309.2 HOX 115..168 CDD:197696 16/66 (24%)
HALZ 170..208 CDD:280364 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.