DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and HB22

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_850266.1 Gene:HB22 / 818233 AraportID:AT2G36610 Length:185 Species:Arabidopsis thaliana


Alignment Length:105 Identity:30/105 - (28%)
Similarity:48/105 - (45%) Gaps:17/105 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 GYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRS---------DVAETLNLS 200
            ||.|.    |.|.....:::...|..||.:|||.|:.:..|: .||.         .:::.|.|.
plant    57 GYGEE----SNSFNGQEKKKKKMTSEQLKFLERSFQEEIKLN-PDRKMKLNPDRKMKLSKELGLQ 116

  Fly   201 ETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQD 240
            ..|:..|:|||:.:||.:   :||.|......|.|.|.::
plant   117 PRQIAVWFQNRKARWKNK---QLEHLYESLRQEFDIVSRE 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 17/61 (28%)
HB22NP_850266.1 Homeobox 76..133 CDD:395001 18/57 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.