DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and HDG3

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_180796.2 Gene:HDG3 / 817798 AraportID:AT2G32370 Length:725 Species:Arabidopsis thaliana


Alignment Length:153 Identity:43/153 - (28%)
Similarity:63/153 - (41%) Gaps:35/153 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 NGDRDANGG-----SGPGSG------GGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERK 178
            |.:.:.|||     :|..||      |.||.|.....|..:::.|..:::....|..|::.:|..
plant    22 NNNNNNNGGTDNTNAGNDSGDQDFDSGNTSSGNHGEGLGNNQAPRHKKKKYNRHTQLQISEMEAF 86

  Fly   179 FRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQ-------------NQLRLEQLR--- 227
            ||...:.....|.|::..|.|...|:|.|:||:||:.|.|             |.||.|..|   
plant    87 FRECPHPDDKQRYDLSAQLGLDPVQIKFWFQNKRTQNKNQQERFENSELRNLNNHLRSENQRLRE 151

  Fly   228 --HQATMEKDFVVQDGGGAGGLG 248
              |||...|      .||...:|
plant   152 AIHQALCPK------CGGQTAIG 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 16/52 (31%)
HDG3NP_180796.2 Homeobox 71..125 CDD:395001 16/53 (30%)
START_ArGLABRA2_like 247..471 CDD:176884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.