DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Msx1

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_112321.2 Gene:Msx1 / 81710 RGDID:620929 Length:303 Species:Rattus norvegicus


Alignment Length:281 Identity:83/281 - (29%)
Similarity:112/281 - (39%) Gaps:94/281 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 GGGGGVASGLSAAAAAA----------GVAAGLLAAAAS-----------------GANGDRDAN 131
            |||.|.|.|.:||.|.|          .|.|.||..:..                 .:.|.:.|.
  Rat    26 GGGAGQAPGAAAATATAMGTDEEGAKPKVPASLLPFSVEALMADHRKPGAKESVLVASEGAQAAG 90

  Fly   132 G-----GSGPGSGGG----TSGGYAEH-------------------------------------- 149
            |     |:.|||.|.    :|.|...|                                      
  Rat    91 GSVQHLGTRPGSLGAPDAPSSPGPLGHFSVGGLLKLPEDALVKAESPEKLDRTPWMQSPRFSPPP 155

  Fly   150 ---------KLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVK 205
                     .|:..|:.|||   ||.||.|||..||||||.::|||:|:|::.:.:|:|:|||||
  Rat   156 ARRLSPPACTLRKHKTNRKP---RTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVK 217

  Fly   206 TWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAGGLGCCPSGLSSSFSAAAAAAAAASN 270
            .|:||||.|.||..:..||:|:..|   |..:..   .|.||.....|.::..:||.|:..:||.
  Rat   218 IWFQNRRAKAKRLQEAELEKLKMAA---KPMLPP---AAFGLSFPLGGPAAVAAAAGASLYSASG 276

  Fly   271 PCN--FLTSAAAAAIFRNVGY 289
            |..  .|..|.......:|||
  Rat   277 PFQRAALPVAPVGLYTAHVGY 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 31/52 (60%)
Msx1NP_112321.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000776
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.