DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and HAT9

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_179865.1 Gene:HAT9 / 816811 AraportID:AT2G22800 Length:274 Species:Arabidopsis thaliana


Alignment Length:262 Identity:62/262 - (23%)
Similarity:97/262 - (37%) Gaps:73/262 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 ESSVESCLSATRGPGSGTGSGGGGGGGGGGGVASGLSAAAAAAGVAAGLLAAAASGANGDRDANG 132
            |.|:..|||   |..|.|             |.:|...........:| :::.:||....|:.:|
plant    37 EPSLTLCLS---GDPSVT-------------VVTGADQLCRQTSSHSG-VSSFSSGRVVKRERDG 84

  Fly   133 G-SGPGSGGGTS---GGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDV 193
            | ..|.....|.   ..|.|.:..:|      .|::...|..|.|.||..|:....|:...:..:
plant    85 GEESPEEEEMTERVISDYHEDEEGIS------ARKKLRLTKQQSALLEESFKDHSTLNPKQKQVL 143

  Fly   194 AETLNLSETQVKTWYQNRRTKWK-RQNQLRLEQLR--------HQATMEKDFVVQD--------- 240
            |..|||...||:.|:||||.:.| :|.::..|.|:        ....::|:  :|:         
plant   144 ARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLADENIRLQKE--IQELKTLKLTQP 206

  Fly   241 -------------------GGGAGGLGCCPSGLSSSF-----SAAAAAAAAASNP--CNFLTSAA 279
                               |||.||.|....|..::.     |.|..|.:.:|.|  .|..|:.:
plant   207 FYMHMPASTLTKCPSCERIGGGGGGNGGGGGGSGATAVIVDGSTAKGAFSISSKPHFFNPFTNPS 271

  Fly   280 AA 281
            ||
plant   272 AA 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 18/52 (35%)
HAT9NP_179865.1 HOX 112..166 CDD:197696 19/53 (36%)
HALZ 168..211 CDD:128634 5/44 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.