DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and HB17

DIOPT Version :10

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_178252.2 Gene:HB17 / 814671 AraportID:AT2G01430 Length:275 Species:Arabidopsis thaliana


Alignment Length:110 Identity:30/110 - (27%)
Similarity:50/110 - (45%) Gaps:16/110 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 SGPGSGGGTSGGYAEHKLQLSK---------------SGRKPRRRRTAFTHAQLAYLERKFRCQK 183
            |.|.|..|:.||..:.:|.:::               .|..|.|::...|..|...||..||...
plant    95 SSPLSDEGSGGGRDQLRLDMNRLPSSEDGDDEEFSHDDGSAPPRKKLRLTREQSRLLEDSFRQNH 159

  Fly   184 YLSVADRSDVAETLNLSETQVKTWYQNRRTKWK-RQNQLRLEQLR 227
            .|:...:..:|:.|.|...|::.|:||||.:.| :|.::..|.|:
plant   160 TLNPKQKEVLAKHLMLRPRQIEVWFQNRRARSKLKQTEMECEYLK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeodomain 161..217 CDD:459649 18/56 (32%)
HB17NP_178252.2 HOX 136..192 CDD:197696 18/55 (33%)
HALZ 194..237 CDD:128634 3/11 (27%)

Return to query results.
Submit another query.