DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and hmx3

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001072829.1 Gene:hmx3 / 780290 XenbaseID:XB-GENE-483776 Length:306 Species:Xenopus tropicalis


Alignment Length:143 Identity:50/143 - (34%)
Similarity:75/143 - (52%) Gaps:19/143 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 SGPGSGGGTSGGYAEHKLQLSKSGRKPRRR---RTAFTHAQLAYLERKFRCQKYLSVADRSDVAE 195
            |.|..|.....| .:.|.:.....:||.|:   ||.|:.:|:..||..|..::|||.::|:.:|.
 Frog   150 SEPEEGKKDDSG-EDWKKREESPDKKPCRKKKTRTVFSRSQVFQLESTFDMKRYLSSSERAGLAA 213

  Fly   196 TLNLSETQVKTWYQNRRTKWKRQNQLRLE--QLRHQATMEKDFVVQDGGGAGGLGCCPSGLSSSF 258
            :|:|:|||||.|:||||.|||||....||  .|.|.|...   :|:          .|.....:.
 Frog   214 SLHLTETQVKIWFQNRRNKWKRQLAAELEAANLSHAAAQR---IVR----------VPILYHENS 265

  Fly   259 SAAAAAAAAASNP 271
            |:|.:|::||:.|
 Frog   266 SSAESASSAANVP 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 25/55 (45%)
hmx3NP_001072829.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..181 8/31 (26%)
Homeobox 181..235 CDD:365835 26/53 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.