DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Rhox13

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001171931.1 Gene:Rhox13 / 73614 MGIID:1920864 Length:232 Species:Mus musculus


Alignment Length:222 Identity:57/222 - (25%)
Similarity:78/222 - (35%) Gaps:76/222 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 QTDSELEL-SNDDSDIDIEDRSTPDSTAAGCQQELLLSHHHRRFTHHDESSVESCLSATRGPGSG 84
            ::|||.|. |:|.||...:|.||.|                     .|.|..|.           
Mouse    73 ESDSESESDSSDSSDESDDDSSTSD---------------------EDTSDPEE----------- 105

  Fly    85 TGSGGGGGGGGGGGVASGLSAAAAAAGVAAGLLAAAASGANGDRDANGGSGPGSGGGTSGGYAEH 149
                           |:..|.||.||..|...:.|||        |....||             
Mouse   106 ---------------AAAPSVAAVAAAAAPPTVPAAA--------AIQIPGP------------- 134

  Fly   150 KLQLSKSGRKPRRRRTA----FTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQN 210
             .:.....|..||||..    |...|:..:|..|...:|..:..|.::|.|||:.|.:||.|:.|
Mouse   135 -YRYRPPRRHVRRRRRGPPFHFAQWQVEEMESLFEETQYPDLLTRGELARTLNVPEVKVKVWFTN 198

  Fly   211 RRTKWKRQNQLRLEQLRHQATMEKDFV 237
            ||.|.::..  |.|.||:.....:||:
Mouse   199 RRAKQRKIE--RREMLRNIPPGAEDFI 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 20/56 (36%)
Rhox13NP_001171931.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..114 18/87 (21%)
Homeobox 155..204 CDD:278475 18/48 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.