DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Isx

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001281207.1 Gene:Isx / 71597 MGIID:1918847 Length:242 Species:Mus musculus


Alignment Length:153 Identity:40/153 - (26%)
Similarity:59/153 - (38%) Gaps:43/153 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 QLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWK 216
            |..:..:..||.||.||..||..||:.|....|..:..||.:|..:||.|.:|:.|:||:|.||:
Mouse    70 QPQEEKKNKRRVRTTFTTEQLQELEKLFHFTHYPDIHVRSQLASRINLPEARVQIWFQNQRAKWR 134

  Fly   217 RQNQLRLEQLRHQATMEKDFVVQDGGGAGGLGCCPSGLSSSFSAAAAAAAAASNPC--------N 273
            :|.:                                  |.:.||.....:.|...|        .
Mouse   135 KQEK----------------------------------SGNLSAPQQPGSCADTHCYDYIGTSHR 165

  Fly   274 FLTSAAAAAIFRNVGYVHG-CPM 295
            .|.:.:.:|.|:.|.|... |||
Mouse   166 MLPTLSDSAPFKLVPYTDSPCPM 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 22/52 (42%)
IsxNP_001281207.1 Homeobox 82..134 CDD:278475 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.