powered by:
Protein Alignment CG11085 and LOC691272
DIOPT Version :9
Sequence 1: | NP_572815.3 |
Gene: | CG11085 / 32213 |
FlyBaseID: | FBgn0030408 |
Length: | 295 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_001077477.1 |
Gene: | LOC691272 / 691272 |
RGDID: | 1586239 |
Length: | 199 |
Species: | Rattus norvegicus |
Alignment Length: | 65 |
Identity: | 21/65 - (32%) |
Similarity: | 34/65 - (52%) |
Gaps: | 2/65 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 158 RKPRR--RRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQ 220
:||.. |:..||..||..|:|.|...:|.....|.::|:.:|:.|..||.|:..||.|.::..:
Rat 85 QKPTTYYRKLKFTPEQLLELDRVFEETQYPDALQRKELAKLINVEEYTVKIWFNKRRAKIRKHQK 149
Fly 221 220
Rat 150 149
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.