DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Rhox13

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_001077350.3 Gene:Rhox13 / 691244 RGDID:1586264 Length:234 Species:Rattus norvegicus


Alignment Length:227 Identity:57/227 - (25%)
Similarity:86/227 - (37%) Gaps:83/227 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RRQTDSELELSNDDSDI-----DIEDRSTPDSTAAGCQQELLLSHHHRRFTHHDESSVESCLSAT 78
            :::::|:.|.|.||.|.     |.:|.||.|...:..:||                         
  Rat    74 KQESESDTEESYDDEDDDEDEGDEDDLSTSDQDTSDPEQE------------------------- 113

  Fly    79 RGPGSGTGSGGGGGGGGGGGVASGLSAAAAAAGVAAGLLAAAASGANGDRDANGGSGPGSGGGTS 143
                                 .:.|..||||..:|.   ||||....|                 
  Rat   114 ---------------------EAALFVAAAAPPIAP---AAAAIQIPG----------------- 137

  Fly   144 GGYAEHKLQLSKSGRKPRRRRTA---FTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVK 205
                .|:   |:..|..|.||::   ||..|:..:|..|....|..|..|.::|.|||:.|.:||
  Rat   138 ----PHR---SRRRRHRRHRRSSPYLFTQWQVEEMENLFEETPYPDVLTRGELARTLNVPEVKVK 195

  Fly   206 TWYQNRRTKWKRQNQLRLEQLRHQATMEKDFV 237
            .|:.|||.| :|:|: |...||:..:..:||:
  Rat   196 VWFSNRRAK-QRKNE-RRAMLRNMPSGAEDFI 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 22/55 (40%)
Rhox13XP_001077350.3 Homeobox 157..206 CDD:278475 20/49 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.