DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and En1

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_001056699.4 Gene:En1 / 685360 RGDID:1595088 Length:409 Species:Rattus norvegicus


Alignment Length:218 Identity:65/218 - (29%)
Similarity:95/218 - (43%) Gaps:62/218 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 ATRGP--GSGTGSGGGGGGGGGGGVASGLSAAAAAAGVAAGLLAAAASGANGDRDANGGSG--PG 137
            |..||  ||...:..|.|....|..|   :||||||..||..:||||:.|:...|:.||||  .|
  Rat   190 ANCGPPDGSQPATAVGAGASKAGNPA---AAAAAAAAAAAAAVAAAAAAASKPSDSGGGSGGSAG 251

  Fly   138 SGGGTSGGYAEH----------------------------------------------KLQLSKS 156
            |.|.....:.||                                              ||:..|:
  Rat   252 SPGAQGAKFPEHNPAILLMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKN 316

  Fly   157 GRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKR---- 217
            .::.:|.|||||..||..|:.:|:..:|::...|..:|:.|:|:|:|:|.|:||:|.|.|:    
  Rat   317 EKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKKATGI 381

  Fly   218 QNQLRLEQL-----RHQATMEKD 235
            :|.|.|..:     .|..|..:|
  Rat   382 KNGLALHLMAQGLYNHSTTTVQD 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 22/52 (42%)
En1XP_001056699.4 Homeobox 323..377 CDD:395001 22/53 (42%)
Engrail_1_C_sig 378..408 CDD:402244 6/27 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.