DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Mnx1

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001258203.1 Gene:Mnx1 / 682076 RGDID:1588091 Length:403 Species:Rattus norvegicus


Alignment Length:297 Identity:87/297 - (29%)
Similarity:104/297 - (35%) Gaps:128/297 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 VESCLSATRGPGSGTGSGGGG-------------------------------------------- 91
            |.|..:...|||.| ||||||                                            
  Rat    31 VTSLAATPSGPGRG-GSGGGGTSSGASRSCSPASSEATAAPGDRLRAESPSPPRLLTAHCALLPK 94

  Fly    92 ----GGGGGGGVASG------------------LSAAAAAAGVAAGL------------------ 116
                |.|||||.|.|                  .:|||||.|:|.||                  
  Rat    95 PGFLGAGGGGGAAGGPGTPHHHAHPGAAAAAAAAAAAAAAGGLALGLHPGGAQGGAGLPAQAALY 159

  Fly   117 --------LAAAASGANGDRDANGGSGPGSGG------------GTSGGYAEHKLQLSKSGR--- 158
                    .||||:...|...|...|.|...|            |......:..|:.|.:|.   
  Rat   160 GHPVYSYSAAAAAAALAGQHPALSYSYPQVQGAHPAHPADPIKLGAGTFQLDQWLRASTAGMILP 224

  Fly   159 ---------------KPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWY 208
                           |.||.|||||..||..||.:|:..||||...|.:||.:|.|:|||||.|:
  Rat   225 KMPDFSSQAQSNLLGKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWF 289

  Fly   209 QNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAG 245
            ||||.||||..:.: ||...:|..:|.    .|||||
  Rat   290 QNRRMKWKRSKKAK-EQAAQEAEKQKG----SGGGAG 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 30/52 (58%)
Mnx1NP_001258203.1 Homeobox 244..297 CDD:278475 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.