Sequence 1: | NP_572815.3 | Gene: | CG11085 / 32213 | FlyBaseID: | FBgn0030408 | Length: | 295 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001258203.1 | Gene: | Mnx1 / 682076 | RGDID: | 1588091 | Length: | 403 | Species: | Rattus norvegicus |
Alignment Length: | 297 | Identity: | 87/297 - (29%) |
---|---|---|---|
Similarity: | 104/297 - (35%) | Gaps: | 128/297 - (43%) |
- Green bases have known domain annotations that are detailed below.
Fly 71 VESCLSATRGPGSGTGSGGGG-------------------------------------------- 91
Fly 92 ----GGGGGGGVASG------------------LSAAAAAAGVAAGL------------------ 116
Fly 117 --------LAAAASGANGDRDANGGSGPGSGG------------GTSGGYAEHKLQLSKSGR--- 158
Fly 159 ---------------KPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWY 208
Fly 209 QNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAG 245 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11085 | NP_572815.3 | Homeobox | 163..216 | CDD:278475 | 30/52 (58%) |
Mnx1 | NP_001258203.1 | Homeobox | 244..297 | CDD:278475 | 30/52 (58%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |