DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Tlx2

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001165596.1 Gene:Tlx2 / 680117 RGDID:1595506 Length:284 Species:Rattus norvegicus


Alignment Length:235 Identity:72/235 - (30%)
Similarity:100/235 - (42%) Gaps:71/235 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LLSHHHRRFTHHDESS--VESCLSATRGPGSGTGSGG-GGGGGGGGGVASGLSAAAAAAGVAAGL 116
            :|:.||  ..||:..|  ::..||....||.|.|.|. |...|.....:||....:..|  .||.
  Rat     5 VLAPHH--LPHHEPISFGIDQILSGPEPPGGGLGPGQVGQSQGESAAFSSGFHGTSGYA--PAGS 65

  Fly   117 LAAAASGANGDRDANGGSGPG--------------------------SGGGTSGGYAEHKLQLSK 155
            ||:...|:        |.|||                          ||.|..||.|........
  Rat    66 LASLPRGS--------GVGPGGVIRVPAHRPVPVPPPSGAAPAVAGPSGLGGPGGLAGLTFPWMD 122

  Fly   156 SGRK----------------------------PRRR--RTAFTHAQLAYLERKFRCQKYLSVADR 190
            |||:                            |:|:  ||:|:.:|:..|||:|..||||:.|:|
  Rat   123 SGRRFAKDRLTAALSPFSGTRRIGHPYQNRTPPKRKKPRTSFSRSQVLELERRFLRQKYLASAER 187

  Fly   191 SDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQA 230
            :.:|:.|.:::.|||||:|||||||:||.....|..||:|
  Rat   188 AALAKALRMTDAQVKTWFQNRRTKWRRQTAEEREAERHRA 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 27/54 (50%)
Tlx2NP_001165596.1 Homeobox 160..213 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.