DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and ALX4

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_068745.2 Gene:ALX4 / 60529 HGNCID:450 Length:411 Species:Homo sapiens


Alignment Length:205 Identity:52/205 - (25%)
Similarity:89/205 - (43%) Gaps:39/205 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 GVAAGLLAAAASGANGDRDANGGSGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYL 175
            |:.:..|:...:|..|.:|......|..        .|.....|..|:| ||.||.||..||..|
Human   174 GMDSSYLSVKEAGVKGPQDRASSDLPSP--------LEKADSESNKGKK-RRNRTTFTSYQLEEL 229

  Fly   176 ERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQL-RLEQLR------------ 227
            |:.|:...|..|..|..:|...:|:|.:|:.|:||||.||:::.:. :::|:|            
Human   230 EKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWRKRERFGQMQQVRTHFSTAYELPLL 294

  Fly   228 ----HQATMEKDFVVQDGGGAGGLGCC-------PSGLSSSFSAAAAAAAAASNPCNFLTSAAAA 281
                :.|.::....:.:.|.|..:..|       |:.:|..   |....:.||:..:||:.:.|.
Human   295 TRAENYAQIQNPSWLGNNGAASPVPACVVPCDPVPACMSPH---AHPPGSGASSVTDFLSVSGAG 356

  Fly   282 AIFRNVGYVH 291
            :   :||..|
Human   357 S---HVGQTH 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 22/52 (42%)
ALX4NP_068745.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..145
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 184..219 10/43 (23%)
Homeobox 218..270 CDD:278475 22/51 (43%)
OAR 387..404 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 391..404
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.