Sequence 1: | NP_572815.3 | Gene: | CG11085 / 32213 | FlyBaseID: | FBgn0030408 | Length: | 295 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_068745.2 | Gene: | ALX4 / 60529 | HGNCID: | 450 | Length: | 411 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 52/205 - (25%) |
---|---|---|---|
Similarity: | 89/205 - (43%) | Gaps: | 39/205 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 111 GVAAGLLAAAASGANGDRDANGGSGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYL 175
Fly 176 ERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQL-RLEQLR------------ 227
Fly 228 ----HQATMEKDFVVQDGGGAGGLGCC-------PSGLSSSFSAAAAAAAAASNPCNFLTSAAAA 281
Fly 282 AIFRNVGYVH 291 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11085 | NP_572815.3 | Homeobox | 163..216 | CDD:278475 | 22/52 (42%) |
ALX4 | NP_068745.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 75..145 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 184..219 | 10/43 (23%) | |||
Homeobox | 218..270 | CDD:278475 | 22/51 (43%) | ||
OAR | 387..404 | CDD:281777 | |||
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 | 391..404 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |