DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and Crx

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_068627.1 Gene:Crx / 60446 RGDID:620511 Length:299 Species:Rattus norvegicus


Alignment Length:149 Identity:44/149 - (29%)
Similarity:69/149 - (46%) Gaps:10/149 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 GTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVK 205
            |.|.......:..|.:.||.||.||.||.:||..||..|...:|..|..|.:||..:||.|::|:
  Rat    20 GPSVDLMHQAVPYSSAPRKQRRERTTFTRSQLEELEALFAKTQYPDVYAREEVALKINLPESRVQ 84

  Fly   206 TWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAG---GLGCC--PSGLSSSFSAAAAAA 265
            .|::|||.|.::|.|.:.:|.:......|....:...|..   ....|  |.|:|.|:|.:....
  Rat    85 VWFKNRRAKCRQQRQQQKQQQQPPGVQAKARPAKRKAGTSPRPSTDVCTDPLGISDSYSPSLPGP 149

  Fly   266 AAASNPCNFLTSAAAAAIF 284
            :.:..     |:.|..:|:
  Rat   150 SGSPT-----TAVATVSIW 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 23/52 (44%)
CrxNP_068627.1 Homeobox 43..93 CDD:278475 22/49 (45%)
TF_Otx 164..249 CDD:281521 44/149 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.