DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and hoxa4a

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_571610.1 Gene:hoxa4a / 58050 ZFINID:ZDB-GENE-000823-4 Length:245 Species:Danio rerio


Alignment Length:138 Identity:43/138 - (31%)
Similarity:67/138 - (48%) Gaps:35/138 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 LLAAAASGANGDRDAN--GGSGPGSGGGTSGGYAEHKLQLSK--------------------SGR 158
            |...:..|::|::|.:  ..:.|||             |.||                    ||.
Zfish    94 LTTESCVGSDGNKDCSLVSDALPGS-------------QKSKEPVVYPWMKKVHVNTVTASYSGG 145

  Fly   159 KPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRL 223
            .|:|.|||:|..|...||::|...:||:...|.::|.|:.|||.|||.|:||||.|||:.::|..
Zfish   146 VPKRSRTAYTRQQALELEKEFHFNRYLTRRRRVEIAHTMCLSERQVKIWFQNRRMKWKKDHKLPN 210

  Fly   224 EQLRHQAT 231
            .::|..::
Zfish   211 TKIRSSSS 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 25/52 (48%)
hoxa4aNP_571610.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..99 1/4 (25%)
Antp-type hexapeptide 126..131 0/4 (0%)
Homeobox 150..203 CDD:278475 25/52 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 205..245 2/14 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.