powered by:
Protein Alignment CG11085 and Drgx
DIOPT Version :9
Sequence 1: | NP_572815.3 |
Gene: | CG11085 / 32213 |
FlyBaseID: | FBgn0030408 |
Length: | 295 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001097075.2 |
Gene: | Drgx / 5740176 |
FlyBaseID: | FBgn0085369 |
Length: | 587 |
Species: | Drosophila melanogaster |
Alignment Length: | 72 |
Identity: | 32/72 - (44%) |
Similarity: | 44/72 - (61%) |
Gaps: | 0/72 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 158 RKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLR 222
||.||.||.||..||..||..|....|..|..|.|:|..:||:|.:|:.|:||||.||::..:|:
Fly 50 RKQRRNRTTFTLQQLEELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWRKAERLK 114
Fly 223 LEQLRHQ 229
.||.:.:
Fly 115 DEQRKRE 121
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG11085 | NP_572815.3 |
Homeobox |
163..216 |
CDD:278475 |
24/52 (46%) |
Drgx | NP_001097075.2 |
Homeobox |
56..108 |
CDD:278475 |
24/51 (47%) |
OAR |
428..445 |
CDD:281777 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
45 |
1.000 |
Domainoid score |
I3555 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.