DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and bsx

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_999892.1 Gene:bsx / 573364 ZFINID:ZDB-GENE-040628-4 Length:227 Species:Danio rerio


Alignment Length:88 Identity:40/88 - (45%)
Similarity:56/88 - (63%) Gaps:6/88 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 TSG----GYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSET 202
            |||    ...:|..:|.....:.|:.||.|:.:||:.||::|..|:|||..:|.::|..|:||||
Zfish    83 TSGMQMPALFQHHPELPGKHCRRRKARTVFSDSQLSGLEKRFEIQRYLSTPERVELATALSLSET 147

  Fly   203 QVKTWYQNRRTKWKRQNQLRLEQ 225
            |||||:||||.|.|:  |||..|
Zfish   148 QVKTWFQNRRMKHKK--QLRKTQ 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 29/52 (56%)
bsxNP_999892.1 Homeobox 109..161 CDD:278475 29/51 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..227 7/14 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.