DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and AgaP_AGAP012428

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_001688571.1 Gene:AgaP_AGAP012428 / 5668381 VectorBaseID:AGAP012428 Length:279 Species:Anopheles gambiae


Alignment Length:162 Identity:67/162 - (41%)
Similarity:81/162 - (50%) Gaps:36/162 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 DRDAN---GGSGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLSVA 188
            |.|.|   .|.|..|..|.|              :|.|:.|||||..||..||:.|..||||||.
Mosquito     3 DEDGNSIKNGLGLSSSSGLS--------------KKQRKARTAFTDHQLQTLEKSFERQKYLSVQ 53

  Fly   189 DRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLR---HQATMEKDFVVQDGGGAGGLGC- 249
            ||.::|..|.||:|||||||||||||||||..:.||.|.   :.|..::.:     ||...:|. 
Mosquito    54 DRMELANKLGLSDTQVKTWYQNRRTKWKRQTAVGLELLAEAGNYAAFQRLY-----GGPPYIGAW 113

  Fly   250 ---CPSGLSSSFSAA-------AAAAAAASNP 271
               .|||...:..:|       ||||||...|
Mosquito   114 PYPTPSGPPGTSQSAVDAYYRHAAAAAALQKP 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 35/52 (67%)
AgaP_AGAP012428XP_001688571.1 Homeobox 29..81 CDD:278475 35/51 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1387
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.