DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and AgaP_AGAP011253

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_001688185.1 Gene:AgaP_AGAP011253 / 5667880 VectorBaseID:AGAP011253 Length:401 Species:Anopheles gambiae


Alignment Length:306 Identity:72/306 - (23%)
Similarity:108/306 - (35%) Gaps:94/306 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QSSKSFLIRDLLGDLINRRQTDSELELSNDDSDIDIEDRSTPDSTAAGCQQELLLSHHHRRFTHH 66
            |.|:.|.|.::| :|.|::....:...:.|...:.....||.:|.....|..|.::   ...::.
Mosquito    63 QRSQRFHISNIL-ELNNQQHQHQDQPATKDQPSVASLSSSTLESQQHATQPSLDVT---APTSYP 123

  Fly    67 DE-----------SSVESC--LSATRGPGS-GTG------------------SGGGGGGGGGGGV 99
            |:           |...||  |.....|.: |||                  .|||....|..||
Mosquito   124 DDQSAALPYGTMSSQTASCLPLQPVLNPSAIGTGIPYDPPPYYSYSHHAHHLFGGGSAALGSSGV 188

  Fly   100 AS----------------------GLSAAAAAAG------------------VAAGLLAAAASGA 124
            .|                      .||..:.:.|                  .:..|:|..:.|.
Mosquito   189 VSEPPRSSYSYGGVNLDYANSSNQQLSPDSTSPGPELYSLASYSNIPRVVNEASDRLVALESDGP 253

  Fly   125 NGDR----DANGGS--------------GPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQ 171
            :.|.    |.|..:              .||.....|||:.......:..|.|.|:||..|:.:|
Mosquito   254 SLDPECSVDTNNNNNNHHTPDDTPDDLDSPGPRASRSGGHRGESGCGTGGGHKKRKRRILFSKSQ 318

  Fly   172 LAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKR 217
            ...|||:|:..:|||..:|..:|..:||:.||||.|:||.|.|.||
Mosquito   319 TFELERRFKQARYLSAPEREHLASMINLTPTQVKIWFQNHRYKTKR 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 24/52 (46%)
AgaP_AGAP011253XP_001688185.1 Homeobox 310..363 CDD:278475 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.