DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and AgaP_AGAP002372

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_001688391.2 Gene:AgaP_AGAP002372 / 5667563 VectorBaseID:AGAP002372 Length:457 Species:Anopheles gambiae


Alignment Length:370 Identity:97/370 - (26%)
Similarity:131/370 - (35%) Gaps:128/370 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SSKSFLIRDLLGDL-------INRRQTDSELELSNDDSDIDIEDRSTPDSTAAGCQQELLLSHHH 60
            |.:.|..| |.|.|       ||.....|    :|..|| ::.||:...:.........|:...|
Mosquito    41 SPRKFFER-LYGHLERDDKSVINNNNNGS----ANGSSD-EVRDRNVHVTVTKASDPCALIDETH 99

  Fly    61 RRFTHHD---ESSVESCLSATRGPGSGT-------------------GSGGGGGGGGGG------ 97
             |:.|||   .|:.:..:|......||:                   ||.|...|||..      
Mosquito   100 -RYHHHDHNSSSNSQKSVSVNSSISSGSPRSSLAVDIEEDSSQDASIGSPGLQPGGGDHPRQPPA 163

  Fly    98 -------GVASGLSAAAAA--------AGVAAGLLAAA---ASGAN------------GDRDANG 132
                   |:.|..|.|.|:        .|...|.||..   :|.|.            ||....|
Mosquito   164 YPPLRHYGITSSSSTACASEYPVPTTIGGQCYGFLAVTPQQSSSAGVLPVPAPHLTQPGDPALVG 228

  Fly   133 G-----------------SGPGSGGGTSG--------GYAEHKLQL------------SKSGRKP 160
            |                 |..|:|||..|        |.|....||            .|.|| |
Mosquito   229 GLQHRPQHGSMAVSTFFSSTGGAGGGGYGPPSFRPFFGIAHDGPQLPAGLSAFLARRRKKEGR-P 292

  Fly   161 RRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQ 225
            ||:||.|:..|...||.:|...:|:|...|.::||.|.|||||:|.|:||||.|.||..:.:::|
Mosquito   293 RRQRTTFSSEQTLRLEVEFHRNEYISRGRRFELAEVLKLSETQIKIWFQNRRAKDKRIEKAQIDQ 357

  Fly   226 LRHQATMEKDFVVQDGGGAGGLGCCPSGLSSSFSAAAAAAAAASN 270
                  ..:.|            ...:||.:.||....||..|::
Mosquito   358 ------QYRTF------------AAVNGLLTPFSPQYPAALIATH 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 25/52 (48%)
AgaP_AGAP002372XP_001688391.2 Homeobox 296..348 CDD:278475 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.