powered by:
Protein Alignment CG11085 and lbx1a
DIOPT Version :9
Sequence 1: | NP_572815.3 |
Gene: | CG11085 / 32213 |
FlyBaseID: | FBgn0030408 |
Length: | 295 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001020703.1 |
Gene: | lbx1a / 564103 |
ZFINID: | ZDB-GENE-040724-40 |
Length: | 269 |
Species: | Danio rerio |
Alignment Length: | 70 |
Identity: | 35/70 - (50%) |
Similarity: | 48/70 - (68%) |
Gaps: | 4/70 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 158 RKPRRRRTAFTHAQLAYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLR 222
:|.|:.|||||:.|:..||::|..|||||.|||..:|:.|.|:..||.||:||||.|.||.
Zfish 123 KKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRD---- 183
Fly 223 LEQLR 227
||:::
Zfish 184 LEEMK 188
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0488 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.900 |
|
Return to query results.
Submit another query.