DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and hmx2

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001108570.3 Gene:hmx2 / 555632 ZFINID:ZDB-GENE-080506-2 Length:269 Species:Danio rerio


Alignment Length:247 Identity:64/247 - (25%)
Similarity:94/247 - (38%) Gaps:83/247 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SFLIRDLLG---DLINRRQTDS--------ELELSNDD--------SDIDIEDRSTPDSTAAGCQ 51
            ||.|:.:||   |.:.....||        .|.:|::|        .|....:...|:|    |.
Zfish    18 SFTIQSILGTSNDGVRSAGKDSPKSQPRKRTLSVSSEDDCSAGEDSGDCYCSEPGVPES----CN 78

  Fly    52 QELLLSHHHRRFTHHDESSVESCLSATRG--PGSGTGSGGGGGGGGGGGVASGLS-------AAA 107
                 .|....|          ||.||:|  |                 |..|:.       :..
Zfish    79 -----PHQPLNF----------CLGATKGLLP-----------------VQDGIDRRPHLTPSIL 111

  Fly   108 AAAGVAAGLLAAAASGANGDRDANGGSGPGSGGGTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQL 172
            .......|...:..|..:.||..:|..                 :.:.|.:|  :.||.|:.:|:
Zfish   112 PDYKEEQGRACSQMSPVSEDRQRDGPD-----------------KQNNSAKK--KTRTVFSRSQV 157

  Fly   173 AYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLE 224
            ..||..|..::|||.::|:.:|.:|.|:|||||||:||||.|||||....||
Zfish   158 YQLESTFDMKRYLSSSERACLASSLQLTETQVKTWFQNRRNKWKRQLSAELE 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 26/52 (50%)
hmx2NP_001108570.3 Homeobox 148..201 CDD:306543 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.