DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and nkx3-1

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001373254.1 Gene:nkx3-1 / 555375 ZFINID:ZDB-GENE-081104-238 Length:185 Species:Danio rerio


Alignment Length:180 Identity:59/180 - (32%)
Similarity:85/180 - (47%) Gaps:38/180 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 ANGDRDANGGSGPGSGG--GTSGGYAEHKLQLSKSGRKPRRRRTAFTHAQLAYLERKFRCQKYLS 186
            |..|||.:......|..  .||.|......:::..|.|.:|.|.||||.|:..||:||..|:|||
Zfish    31 AESDRDDSTDRQTDSADTCRTSEGKTVSSTEMTGGGGKKKRSRAAFTHLQVLELEKKFSRQRYLS 95

  Fly   187 VADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAGGLGCCP 251
            ..:|:.:|..|:|:|||||.|:||||.|.||: ||..|.       .||:               
Zfish    96 APERTHLASALHLTETQVKIWFQNRRYKTKRR-QLTTEH-------SKDY--------------- 137

  Fly   252 SGLSSSFSAAAAAAAAASNPCNFLTSAAAAAIFRNVGY------VHGCPM 295
                  |..:.|||.||:.. :|..::..|.::::..|      :||..|
Zfish   138 ------FQKSNAAAMAATEE-DFFRASLLATVYKSSPYRPYVYDLHGLSM 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 29/52 (56%)
nkx3-1NP_001373254.1 COG5576 15..>136 CDD:227863 45/112 (40%)
Homeobox 72..126 CDD:395001 29/53 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.