DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11085 and barhl1b

DIOPT Version :9

Sequence 1:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001018142.1 Gene:barhl1b / 553186 ZFINID:ZDB-GENE-060118-2 Length:323 Species:Danio rerio


Alignment Length:249 Identity:81/249 - (32%)
Similarity:103/249 - (41%) Gaps:57/249 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LELSNDDSDIDIEDR----------STPDSTAAGCQQELLLSHHHRRFTHHDESSVESCLSATRG 80
            :|.|.:.|...|:..          |..||....|:..|..|         ..|.:||..|:...
Zfish     1 MEASTNGSSFGIDSLLSHRPGSPVISKGDSLVGECRSPLEFS---------PRSDLESGCSSPPS 56

  Fly    81 PGSGTGSGGGGGGGGGGGVASGLSAAAAAAG-----VAAGLL------------AAAASGANGDR 128
            |............|.....||.|.....:||     ||:..|            |.|...:||..
Zfish    57 PRRECVEDAAQRQGHPLAYASHLQHGPISAGSQPRTVASSFLIRDILADCKPLAACAPYSSNGQP 121

  Fly   129 DANGGSGPGSGG--------GTSGGYAEHKL------QLSKSG-------RKPRRRRTAFTHAQL 172
            ....|.......        ..|...:|:|:      ::|.|.       :|||:.|||||..||
Zfish   122 TQEAGRLASKIADDLIEKIHSNSSSDSEYKVKEEGDREISSSRDSPQVRLKKPRKARTAFTDHQL 186

  Fly   173 AYLERKFRCQKYLSVADRSDVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQL 226
            |.|||.|..||||||.||.::|.:|||::|||||||||||||||||..:.||.|
Zfish   187 AQLERSFERQKYLSVQDRMELAASLNLTDTQVKTWYQNRRTKWKRQTAVGLELL 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11085NP_572815.3 Homeobox 163..216 CDD:278475 37/52 (71%)
barhl1bNP_001018142.1 Oxidoreductase_nitrogenase 48..>88 CDD:295466 9/39 (23%)
Homeobox 178..230 CDD:278475 37/51 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1387
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.